Back to browse

EXP000317

Paper

HOPS-dependent endosomal fusion required for efficient cytosolic delivery of therapeutic peptides and small proteins (2019)

Peptide

aPP5.3

Sequence: GPSQPTYPGDDAPVRDLIRFYRDLRRYLNVVTR-CONH2

RNA

RNA, unspecified

All experiment fields

Experiment Id EXP000317
Paper HOPS-dependent endosomal fusion required for efficient cytosolic delivery of therapeutic peptides an
Peptide aPP5.3
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence yes
Peptide Concentration 300–600 nM (typical); up to 2 µM in leakage assays
Rna Concentration
Mixing Ratio
Formulation Format free peptide
Formulation Components aPP5.3
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells Saos-2, HeLa
Animal Model
Administration Route
Output Type cytosolic peptide delivery
Output Value
Output Units
Output Notes Efficient cytosolic and nuclear delivery measured by FCS/confocal imaging; delivery requires HOPS complex; no RNA cargo used
Toxicity Notes Low toxicity below 2 µM
Curation Notes