Back to browse

EXP000971

Paper

Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Reed Phragmites australis via Foliar Application (2025)

Peptide

γ-zein-CADY

Sequence: VRLPPPVRLPPPVRLPPPGGLWRALWRLLRSLWRLLWKGGFWFG

RNA

siRNA

All experiment fields

Experiment Id EXP000971
Paper Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Re
Peptide γ-zein-CADY
Delivery Success Class yes
In Vivo Flag yes
Uptake Confirmed yes
Label Confidence medium
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration not reported (charge ratio 1:1; 50 µL/leaf)
Rna Concentration 1 nmol dsRNA/leaf
Mixing Ratio CPP:GSA charge ratio 1:1
Formulation Format CPP:GSA electrostatic complex (topical foliar)
Formulation Components Infiltration medium: 10% sucrose (w/v) + 0.08% Silwet L-77; CPP dissolved in 50% DMSO then diluted; foliar application 50 µL/leaf
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo (plant)
Cell Lines Or Primary Cells
Animal Model Phragmites australis ssp. australis (greenhouse-grown plants)
Administration Route foliar topical application (adaxial leaf surface)
Output Type in vivo gene knockdown (RT-qPCR, PDS/Actin)
Output Value 38
Output Units
Output Notes Experiment 1: significant ~38% reduction in PDS transcript at 5 days post treatment (DPT); earlier timepoints not significant.
Toxicity Notes
Curation Notes