Back to browse

EXP000973

Paper

Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Reed Phragmites australis via Foliar Application (2025)

Peptide

γ-zein-CADY

Sequence: VRLPPPVRLPPPVRLPPPGGLWRALWRLLRSLWRLLWKGGFWFG

RNA

ASO

All experiment fields

Experiment Id EXP000973
Paper Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Re
Peptide γ-zein-CADY
Delivery Success Class no
In Vivo Flag yes
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration 5.4 nmol CPP/leaf
Rna Concentration 1 nmol ASO pool/leaf
Mixing Ratio ASO:CPP charge ratio 1:6.25
Formulation Format CPP:GSA electrostatic complex (topical foliar)
Formulation Components Infiltration medium: 10% sucrose (w/v) + 0.08% Silwet L-77; CPP dissolved in 50% DMSO then diluted; foliar application 50 µL/leaf
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo (plant)
Cell Lines Or Primary Cells
Animal Model Phragmites australis ssp. australis (greenhouse-grown plants)
Administration Route foliar topical application (adaxial leaf surface)
Output Type in vivo gene knockdown (RT-qPCR, PDS/Actin)
Output Value
Output Units
Output Notes ASO pool A (ASO-1 to ASO-12): no significant reduction vs CPP-only control at 4 DPT or 7 DPT.
Toxicity Notes
Curation Notes