Back to browse

EXP000984

Paper

Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Reed Phragmites australis via Foliar Application (2025)

Peptide

γ-zein-CADY

Sequence: VRLPPPVRLPPPVRLPPPGGLWRALWRLLRSLWRLLWKGGFWFG

RNA

miRNA

All experiment fields

Experiment Id EXP000984
Paper Cell-Penetrating Peptide-Mediated Delivery of Gene-Silencing Nucleic Acids to the Invasive Common Re
Peptide γ-zein-CADY
Delivery Success Class no
In Vivo Flag yes
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration not reported
Rna Concentration not reported
Mixing Ratio not reported
Formulation Format CPP:GSA electrostatic complex (topical foliar)
Formulation Components Infiltration medium: 10% sucrose (w/v) + 0.08% Silwet L-77; CPP dissolved in 50% DMSO then diluted; foliar application 50 µL/leaf
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo (plant)
Cell Lines Or Primary Cells
Animal Model Phragmites australis ssp. australis (greenhouse-grown plants)
Administration Route foliar topical application (adaxial leaf surface)
Output Type in vivo gene knockdown (RT-qPCR, PDS/Actin)
Output Value
Output Units
Output Notes PCR-amplified amiRNAPDS cassette delivered by γ-zein-CADY: no statistically significant gene silencing at DPT4 or DPT7.
Toxicity Notes
Curation Notes