Back to browse

EXP001219

Paper

Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)

Peptide

RL2 (recombinant lactaptin)

Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH

RNA

pDNA

All experiment fields

Experiment Id EXP001219
Paper Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin
Peptide RL2 (recombinant lactaptin)
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25
Formulation Format protein–nucleic acid noncovalent complex (polyplex)
Formulation Components RL2:pEGFP complexes formed in 25 mM MES pH 5.5, incubated 5 min at 37°C; tested N/P 5/7/9; pEGFP final 1 ng/µL in Opti-MEM for 3 h then 24 h expression
Size Nm 110.00
Zeta Mv 10.30
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells A549 (human lung adenocarcinoma)
Animal Model
Administration Route
Output Type reporter expression
Output Value EGFP expression observed by fluorescence microscopy; higher with increased N/P (best at N/P=9)
Output Units
Output Notes Compared vs naked plasmid (no signal) and Lipofectamine 3000 (positive control).
Toxicity Notes
Curation Notes