Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)
Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH
| Experiment Id | EXP001219 |
|---|---|
| Paper | Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin |
| Peptide | RL2 (recombinant lactaptin) |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25 |
| Formulation Format | protein–nucleic acid noncovalent complex (polyplex) |
| Formulation Components | RL2:pEGFP complexes formed in 25 mM MES pH 5.5, incubated 5 min at 37°C; tested N/P 5/7/9; pEGFP final 1 ng/µL in Opti-MEM for 3 h then 24 h expression |
| Size Nm | 110.00 |
| Zeta Mv | 10.30 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | A549 (human lung adenocarcinoma) |
| Animal Model | |
| Administration Route | |
| Output Type | reporter expression |
| Output Value | EGFP expression observed by fluorescence microscopy; higher with increased N/P (best at N/P=9) |
| Output Units | |
| Output Notes | Compared vs naked plasmid (no signal) and Lipofectamine 3000 (positive control). |
| Toxicity Notes | |
| Curation Notes |