Back to browse

EXP001220

Paper

Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)

Peptide

RL2 (recombinant lactaptin)

Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH

RNA

pDNA

All experiment fields

Experiment Id EXP001220
Paper Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin
Peptide RL2 (recombinant lactaptin)
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25
Formulation Format protein–nucleic acid noncovalent complex (polyplex)
Formulation Components RL2:pEGFP complexes as above; N/P 5–9
Size Nm 110.00
Zeta Mv 10.30
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells A431 (human epidermoid carcinoma / squamous carcinoma)
Animal Model
Administration Route
Output Type reporter expression / RT-PCR
Output Value EGFP fluorescence observed; EGFP-specific RT-PCR products detected for N/P 5–9; anti-RL2 antibodies partially inhibit entry
Output Units
Output Notes Functional delivery assessed by microscopy and RT-PCR (EGFP transcripts).
Toxicity Notes
Curation Notes