Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)
Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH
| Experiment Id | EXP001220 |
|---|---|
| Paper | Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin |
| Peptide | RL2 (recombinant lactaptin) |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25 |
| Formulation Format | protein–nucleic acid noncovalent complex (polyplex) |
| Formulation Components | RL2:pEGFP complexes as above; N/P 5–9 |
| Size Nm | 110.00 |
| Zeta Mv | 10.30 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | A431 (human epidermoid carcinoma / squamous carcinoma) |
| Animal Model | |
| Administration Route | |
| Output Type | reporter expression / RT-PCR |
| Output Value | EGFP fluorescence observed; EGFP-specific RT-PCR products detected for N/P 5–9; anti-RL2 antibodies partially inhibit entry |
| Output Units | |
| Output Notes | Functional delivery assessed by microscopy and RT-PCR (EGFP transcripts). |
| Toxicity Notes | |
| Curation Notes |