Sequence: GLFGAIAGFIENGWEGMIDGRQIKIWFQNRRMKWKK
| Experiment Id | EXP001416 |
|---|---|
| Paper | The Study of Cell-Penetrating Peptides to Deliver dsRNA and siRNA by Feeding in the Desert Locust, S |
| Peptide | HA2-penetratin |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | screened across ratios; stability reported for 5:1 w:w and 10:1 w:w (CPP:dsRNA) |
| Formulation Format | noncovalent CPP:dsRNA complexes |
| Formulation Components | Incubated in S. gregaria midgut enzyme solution (MgES) for ex vivo degradation assay; analyzed by agarose gel |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | |
| Animal Model | Schistocerca gregaria midgut enzyme solution (MgES) ex vivo |
| Administration Route | |
| Output Type | dsRNA stability in MgES (gel shift/degradation assay) |
| Output Value | Complex stability depends on ratio; EB1 stable at ≥5:1 w:w up to 120 min; others screened for complexation/protection |
| Output Units | |
| Output Notes | Five CPPs were tested for dsRNA complexation and protection against degradation in MgES (Results 3.1; Figures 2–6). |
| Toxicity Notes | |
| Curation Notes |