Back to browse

EXP001416

Paper

The Study of Cell-Penetrating Peptides to Deliver dsRNA and siRNA by Feeding in the Desert Locust, Schistocerca gregaria (2023)

Peptide

HA2-penetratin

Sequence: GLFGAIAGFIENGWEGMIDGRQIKIWFQNRRMKWKK

RNA

siRNA

All experiment fields

Experiment Id EXP001416
Paper The Study of Cell-Penetrating Peptides to Deliver dsRNA and siRNA by Feeding in the Desert Locust, S
Peptide HA2-penetratin
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio screened across ratios; stability reported for 5:1 w:w and 10:1 w:w (CPP:dsRNA)
Formulation Format noncovalent CPP:dsRNA complexes
Formulation Components Incubated in S. gregaria midgut enzyme solution (MgES) for ex vivo degradation assay; analyzed by agarose gel
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells
Animal Model Schistocerca gregaria midgut enzyme solution (MgES) ex vivo
Administration Route
Output Type dsRNA stability in MgES (gel shift/degradation assay)
Output Value Complex stability depends on ratio; EB1 stable at ≥5:1 w:w up to 120 min; others screened for complexation/protection
Output Units
Output Notes Five CPPs were tested for dsRNA complexation and protection against degradation in MgES (Results 3.1; Figures 2–6).
Toxicity Notes
Curation Notes