Back to browse

EXP001646

Paper

Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy (2017)

Peptide

RVG-9R

Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

RNA

siRNA

All experiment fields

Experiment Id EXP001646
Paper Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy
Peptide RVG-9R
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect no
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration 1.39 µg/well (final in apical compartment, Transwell permeability study)
Mixing Ratio siRNA:peptide = 1:10 (molar); loaded into SLN
Formulation Format Uncoated solid lipid nanoparticles (SLN) encapsulating RVG-9R/siRNA complex
Formulation Components RVG-9R/6-FAM–BACE1 siRNA complex (1:10 molar) encapsulated in SLN (Witepsol E85 lipid; PVA surfactant)
Size Nm 335.76
Zeta Mv -17.31
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells Caco-2 (Transwell epithelial monolayer permeability model)
Animal Model
Administration Route
Output Type Transepithelial transport (basolateral fluorescence RFU over time)
Output Value Higher transport than non-formulated complex; significant increases at 60 and 180 min
Output Units
Output Notes Permeation profiles show increased RFU at basolateral side vs non-formulated complex.
Toxicity Notes Monolayer integrity monitored (Trypan Blue exclusion); no integrity loss reported.
Curation Notes