Back to browse

EXP001647

Paper

Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy (2017)

Peptide

RVG-9R

Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

RNA

siRNA

All experiment fields

Experiment Id EXP001647
Paper Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy
Peptide RVG-9R
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect no
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration 1.39 µg/well (final in apical compartment, Transwell permeability study)
Mixing Ratio siRNA:peptide = 1:10 (molar); loaded into SLN; chitosan coating (NP:CS 1:1 w/w)
Formulation Format Chitosan-coated solid lipid nanoparticles (SLN) encapsulating RVG-9R/siRNA complex
Formulation Components RVG-9R/6-FAM–BACE1 siRNA complex (1:10 molar) encapsulated in SLN, surface-coated with chitosan
Size Nm 358.44
Zeta Mv 10.54
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells Caco-2 (Transwell epithelial monolayer permeability model)
Animal Model
Administration Route
Output Type Transepithelial transport (basolateral fluorescence RFU over time)
Output Value Highest transport among tested formulations; most efficient at 60 min vs uncoated and non-formulated
Output Units
Output Notes Chitosan coating improved permeability (greater RFU) compared with uncoated SLN at key timepoints.
Toxicity Notes Monolayer integrity monitored (Trypan Blue exclusion); no integrity loss reported.
Curation Notes