Engineered Proteinticles for Targeted Delivery of siRNA to Cancer Cells (2015)
Sequence: ECP:GRRGKGG | CAP:MARYRCCRSQSRSRYYRQRQRSRRRRRRSCQTRRRAMRCCRPRYRPRCRRH | CPP(TAT):GRKKRRQRRRPPQ | CTP:VDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK
| Experiment Id | EXP001724 |
|---|---|
| Paper | Engineered Proteinticles for Targeted Delivery of siRNA to Cancer Cells |
| Peptide | Proteinticle(ECP+CAP+CPP+ERP) |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | no |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | Proteinticle carrier; complexes prepared at poly-siRNA:proteinticle 24:1. Assays typically used 100 nM siRNA-equivalent. |
| Rna Concentration | 2 h incubation |
| Mixing Ratio | Poly-siRNA:proteinticle molar ratio 24:1 (complex formation in PBS pH 7.4, 1 h RT) |
| Formulation Format | Engineered ferritin proteinticle / poly-siRNA complex |
| Formulation Components | Human ferritin heavy chain (hFTH) 24-mer proteinticle engineered to display peptide composite NH2–ECP–CAP–CPP–CTP–COOH (or variants lacking CPP/CTP). Poly-siRNA (disulfide-polymerized 5′-thiolated siRNA) electrostatically complexed to CAP on engineered proteinticles. |
| Size Nm | 53.00 |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | MDA-MB-468 human breast cancer (EGFR-expressing); uptake imaged with Cy5.5-labeled proteinticles and YOYO-1-labeled poly-siRNA |
| Animal Model | |
| Administration Route | |
| Output Type | Cellular uptake/targeting (fluorescence microscopy; time-course) |
| Output Value | Higher uptake in MDA-MB-468 when ERP and CPP both present; reduced uptake when CPP or CTP removed |
| Output Units | |
| Output Notes | Quantification provided in Supporting Fig. S5B. |
| Toxicity Notes | Low cytotoxicity by CCK-8 and LDH in B16F10 up to ~1.2 µM complex (reported). |
| Curation Notes |