Target-specific delivery of siRNA into hepatoma cells’ cytoplasm by bifunctional carrier peptide (2017)
Sequence: GRLWDYSWHEGALFLGFLGAAGSTMGAWSQPKSKRKV
| Experiment Id | EXP002318 |
|---|---|
| Paper | Target-specific delivery of siRNA into hepatoma cells’ cytoplasm by bifunctional carrier peptide |
| Peptide | LHRH-MPGΔNLS |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | 1 mg/mL stock |
| Rna Concentration | 30–200 nM siRNA |
| Mixing Ratio | N/P = 10:1 or 20:1 |
| Formulation Format | Peptide/siRNA polyplex (self-assembled) |
| Formulation Components | LHRH-MPGΔNLS + siRNA |
| Size Nm | 142.00 |
| Zeta Mv | 12.00 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | HepG2 (hepatoma); L02 (normal liver) |
| Animal Model | |
| Administration Route | |
| Output Type | Cellular uptake; gene silencing (RT-PCR) |
| Output Value | Near-complete GAPDH knockdown at 200 nM in HepG2; selective vs L02 |
| Output Units | |
| Output Notes | High-content imaging shows preferential uptake in HepG2; cytoplasmic delivery emphasized |
| Toxicity Notes | Low cytotoxicity compared with Lipofectamine 2000 |
| Curation Notes |