Sequence: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
| Experiment Id | EXP002410 |
|---|---|
| Paper | Crotamine/siRNA Nanocomplexes for Functional Downregulation of Syndecan-1 in Renal Proximal Tubular |
| Peptide | Crotamine |
| Delivery Success Class | yes |
| In Vivo Flag | yes |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | |
| Rna Concentration | 0.1 mg/kg siRNA |
| Mixing Ratio | |
| Formulation Format | CPP–siRNA electrostatic nanocomplex |
| Formulation Components | Crotamine + siRNA |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vivo |
| Model Type | in vivo |
| Cell Lines Or Primary Cells | |
| Animal Model | Healthy Swiss mice |
| Administration Route | Intraperitoneal injection |
| Output Type | Biodistribution and in vivo gene knockdown |
| Output Value | Specific uptake in renal proximal tubules; cytosolic siRNA at 24 h |
| Output Units | |
| Output Notes | |
| Toxicity Notes | |
| Curation Notes |