Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC
| Experiment Id | EXP002464 |
|---|---|
| Paper | Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan |
| Peptide | Exenatide-C / MALAT1 ASO 27 |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | medium |
| In Vitro Functional Effect | no |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | covalent peptide-ASO conjugate |
| Formulation Format | GLP1R agonist peptide-ASO conjugate |
| Formulation Components | GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO via indicated linker |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro receptor internalization/cAMP pharmacology |
| Cell Lines Or Primary Cells | U2OS GLP1R internalization assay; HEK293 GLP1R cAMP assay |
| Animal Model | |
| Administration Route | |
| Output Type | GLP1R internalization and cAMP signaling |
| Output Value | Internalization/cAMP activity measured |
| Output Units | |
| Output Notes | In vitro pharmacology/uptake-related assay only; no in vitro target RNA knockdown reported for this row. |
| Toxicity Notes | |
| Curation Notes |