Back to browse

EXP002468

Paper

Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pancreatic Beta Cell (2021)

Peptide

Exenatide-C / MALAT1 ASO 27

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC

RNA

ASO

All experiment fields

Experiment Id EXP002468
Paper Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan
Peptide Exenatide-C / MALAT1 ASO 27
Delivery Success Class no
In Vivo Flag yes
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio covalent peptide-ASO conjugate
Formulation Format GLP1R agonist peptide-ASO conjugate
Formulation Components GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO via indicated linker
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo
Cell Lines Or Primary Cells
Animal Model C57BL/6 mice; isolated pancreatic islets analyzed
Administration Route subcutaneous; once weekly for 3 weeks at 0.006 μmol/kg
Output Type MALAT1 mRNA knockdown in pancreatic islets
Output Value No meaningful in vivo Malat-1 knockdown despite in vitro GLP1R activity
Output Units
Output Notes Tested in vivo but did not show functional target knockdown; negative delivery label.
Toxicity Notes
Curation Notes