Back to browse

EXP001436

Paper

Investigation of LL-37-mediated siRNA transfection (2013)

Peptide

LL-37 (TAMRA-labeled for imaging)

Sequence: [LL-37, 37 aa]

RNA

siRNA

All experiment fields

Experiment Id EXP001436
Paper Investigation of LL-37-mediated siRNA transfection
Peptide LL-37 (TAMRA-labeled for imaging)
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration 17.5 µg/mL TAMRA-LL-37
Rna Concentration 130 nM FITC-GFP siRNA
Mixing Ratio charge ratio 4:1 (LL-37:siRNA)
Formulation Format electrostatic peptide/siRNA complexes
Formulation Components TAMRA-LL-37 + FITC-GFP siRNA
Size Nm 68.00
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells SKBR3 human breast adenocarcinoma cells (confocal microscopy)
Animal Model
Administration Route
Output Type Uptake/localization (confocal microscopy)
Output Value Efficient internalization; cytoplasmic/perinuclear puncta; siRNA not internalized when incubated alone
Output Units
Output Notes Confocal images after overnight incubation in serum-free media show FITC-siRNA internalized when complexed with TAMRA-LL-37, appearing punctate (suggestive of endosomal compartment). Chloroquine increased transfection efficiency (reported as unpublished observation).
Toxicity Notes
Curation Notes