Back to browse

EXP001645

Paper

Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy (2017)

Peptide

RVG-9R

Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

RNA

siRNA

All experiment fields

Experiment Id EXP001645
Paper Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy
Peptide RVG-9R
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration 1.39 µg/well (final in apical compartment, Transwell permeability study)
Mixing Ratio siRNA:peptide = 1:10 (molar)
Formulation Format RVG-9R/siRNA electrostatic complex (not nanoparticle-encapsulated)
Formulation Components 6-FAM–BACE1 siRNA complexed with RVG-9R (siRNA:peptide molar ratio 1:10)
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells Caco-2 (Transwell epithelial monolayer permeability model)
Animal Model
Administration Route
Output Type Transepithelial transport (basolateral fluorescence RFU over time)
Output Value Low transport; earlier onset vs SLN formulations but lower cumulative RFU at later timepoints
Output Units
Output Notes Compared vs SLN-released siRNA; transport increases mainly at 60 and 180 min for SLN formulations.
Toxicity Notes Monolayer integrity monitored (Trypan Blue exclusion); no integrity loss reported.
Curation Notes