Back to browse

EXP002396

Paper

Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Natural Immunity to West Nile Virus (2018)

Peptide

RVG9R

Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

RNA

siRNA

All experiment fields

Experiment Id EXP002396
Paper Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Na
Peptide RVG9R
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence high
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration 25:1 peptide:siRNA molar ratio
Rna Concentration 5–13.5 µg siRNA per dose (in vitro equivalent)
Mixing Ratio 25:1 peptide:siRNA (molar)
Formulation Format Peptide–siRNA electrostatic complex
Formulation Components RVG9R peptide complexed with siRNA (25:1 molar ratio)
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells Primary neuronal cells; Vero cells (for virus assays)
Animal Model
Administration Route
Output Type Gene knockdown (SOD1), uptake
Output Value ~50% SOD1 knockdown across multiple brain regions
Output Units
Output Notes Fluorescence imaging + qPCR; receptor-mediated neuronal uptake
Toxicity Notes
Curation Notes