Back to browse

EXP002461

Paper

Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pancreatic Beta Cell (2021)

Peptide

eGLP-1-C / FOXO1 ASO 3b

Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC

RNA

ASO

All experiment fields

Experiment Id EXP002461
Paper Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan
Peptide eGLP-1-C / FOXO1 ASO 3b
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence medium
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio covalent peptide-ASO conjugate
Formulation Format GLP1R agonist peptide-ASO conjugate
Formulation Components GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO via indicated linker
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro receptor internalization/cAMP pharmacology
Cell Lines Or Primary Cells U2OS GLP1R internalization assay; HEK293 GLP1R cAMP assay
Animal Model
Administration Route
Output Type GLP1R internalization and cAMP signaling
Output Value Internalization/cAMP activity measured
Output Units
Output Notes In vitro pharmacology/uptake-related assay only; no in vitro target RNA knockdown reported for this row.
Toxicity Notes
Curation Notes