Sequence: GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK
| Experiment Id | EXP000026 |
|---|---|
| Paper | Fusogenic-oligoarginine peptide-mediated silencing of the CIP2A oncogene suppresses oral cancer tumo |
| Peptide | INF7-G4-R9-K |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | |
| Formulation Format | peptide/siRNA electrostatic complex |
| Formulation Components | 599 peptide + siCIP2A |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | CAL 27 oral squamous cell carcinoma |
| Animal Model | |
| Administration Route | |
| Output Type | CIP2A knockdown; invasion and anchorage-independent growth |
| Output Value | Significant CIP2A mRNA and protein reduction |
| Output Units | |
| Output Notes | |
| Toxicity Notes | |
| Curation Notes |