Sequence: GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK
| Experiment Id | EXP000027 |
|---|---|
| Paper | Fusogenic-oligoarginine peptide-mediated silencing of the CIP2A oncogene suppresses oral cancer tumo |
| Peptide | INF7-G4-R9-K |
| Delivery Success Class | yes |
| In Vivo Flag | yes |
| Uptake Confirmed | yes |
| Label Confidence | |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | |
| Formulation Format | peptide/siRNA electrostatic complex |
| Formulation Components | 599 peptide + siCIP2A |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vivo |
| Model Type | in vivo |
| Cell Lines Or Primary Cells | |
| Animal Model | CAL 27 oral cancer xenograft (nude / NOD-SCID mice) |
| Administration Route | Intratumoral injection |
| Output Type | tumor growth inhibition |
| Output Value | Reduced tumor volume and weight; CIP2A silencing in tumors |
| Output Units | |
| Output Notes | |
| Toxicity Notes | |
| Curation Notes |