Six-cell penetrating peptide-based fusion proteins for siRNA delivery (2015)
Sequence: Protein 3 (Tat–Tat–Tat–dsRBD PKR): MGSSHHHHHHSSGLVPRGSHMASRKKRRQRRRGHYPYDVP DYAGDRKKRRQRRRGDPAGSRKKRRQRRRSLQPWFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEEFEKLAAALEHHHHHH
| Experiment Id | EXP000230 |
|---|---|
| Paper | Six-cell penetrating peptide-based fusion proteins for siRNA delivery |
| Peptide | Tat-Tat-Tat-dsRBD |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | protein/siRNA molar ratios 1:1–30:1 |
| Rna Concentration | 50–100 nM |
| Mixing Ratio | 1:1–30:1 |
| Formulation Format | CPP–dsRBD fusion protein/siRNA complex |
| Formulation Components | CPP-dsRBD fusion protein + siRNA ± CaCl2 |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | HeLa; GFP-HeLa |
| Animal Model | |
| Administration Route | |
| Output Type | gene knockdown |
| Output Value | Up to ~70% GFP knockdown (protein-dependent) |
| Output Units | |
| Output Notes | Proteins 3, 7, 10, and 11 comparable to Lipofectamine; calcium condensation enhances efficacy |
| Toxicity Notes | Low cytotoxicity overall; some dose-dependent effects |
| Curation Notes |