Sequence: GPSQPTYPGDDAPVRDLIRFYRDLRRYLNVVTR-CONH2
| Experiment Id | EXP000317 |
|---|---|
| Paper | HOPS-dependent endosomal fusion required for efficient cytosolic delivery of therapeutic peptides an |
| Peptide | aPP5.3 |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | 300–600 nM (typical); up to 2 µM in leakage assays |
| Rna Concentration | |
| Mixing Ratio | |
| Formulation Format | free peptide |
| Formulation Components | aPP5.3 |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | Saos-2, HeLa |
| Animal Model | |
| Administration Route | |
| Output Type | cytosolic peptide delivery |
| Output Value | |
| Output Units | |
| Output Notes | Efficient cytosolic and nuclear delivery measured by FCS/confocal imaging; delivery requires HOPS complex; no RNA cargo used |
| Toxicity Notes | Low toxicity below 2 µM |
| Curation Notes |