Human-protein-derived peptides for intracellular delivery of biomolecules (2012)
Sequence: IKKMRRKRSSKMYLKTRAQMPFKVYHYQLKIHFIGYKN
| Experiment Id | EXP000457 |
|---|---|
| Paper | Human-protein-derived peptides for intracellular delivery of biomolecules |
| Peptide | LIP_Con_N |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | |
| Formulation Format | peptide/siRNA screen |
| Formulation Components | CPP + siRNA (screening assay) |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | HeLa cells |
| Animal Model | |
| Administration Route | |
| Output Type | toxicity/transfection screen |
| Output Value | tox |
| Output Units | |
| Output Notes | Phenotype class from Table S1 |
| Toxicity Notes | toxic |
| Curation Notes |