Sequence: GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK
| Experiment Id | EXP001281 |
|---|---|
| Paper | Fusogenic-Oligoarginine Peptide-Mediated Delivery of siRNAs Targeting the CIP2A Oncogene into Oral C |
| Peptide | INF7-G4-R9-K |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | ~5 µM (at 50:1 with 100 nM siRNA) |
| Rna Concentration | 100 nM (typical; some steps start 125 nM then adjusted) |
| Mixing Ratio | 50:1 peptide:siRNA molar (P:N) |
| Formulation Format | Noncovalent electrostatic peptide/siRNA complex |
| Formulation Components | 599 peptide + siCIP2A (or fluorescent DY547-labeled siCIP2A for uptake imaging) in Opti-MEM |
| Size Nm | 80.00 |
| Zeta Mv | 32.50 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | CAL 27 (human tongue squamous cell carcinoma) |
| Animal Model | |
| Administration Route | |
| Output Type | CIP2A mRNA knockdown |
| Output Value | ~60% reduction vs siNT (48 h) |
| Output Units | |
| Output Notes | Protein knockdown shown; DY547-siRNA uptake quantified (~18-fold higher at 50:1 vs siRNA alone) and endocytic localization (EEA1 colocalization). |
| Toxicity Notes | 50:1 showed no significant long-term cytotoxicity; 100:1 caused cytotoxicity |
| Curation Notes |