Back to browse

EXP001281

Paper

Fusogenic-Oligoarginine Peptide-Mediated Delivery of siRNAs Targeting the CIP2A Oncogene into Oral Cancer Cells (2013)

Peptide

INF7-G4-R9-K

Sequence: GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK

RNA

siRNA

All experiment fields

Experiment Id EXP001281
Paper Fusogenic-Oligoarginine Peptide-Mediated Delivery of siRNAs Targeting the CIP2A Oncogene into Oral C
Peptide INF7-G4-R9-K
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence high
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration ~5 µM (at 50:1 with 100 nM siRNA)
Rna Concentration 100 nM (typical; some steps start 125 nM then adjusted)
Mixing Ratio 50:1 peptide:siRNA molar (P:N)
Formulation Format Noncovalent electrostatic peptide/siRNA complex
Formulation Components 599 peptide + siCIP2A (or fluorescent DY547-labeled siCIP2A for uptake imaging) in Opti-MEM
Size Nm 80.00
Zeta Mv 32.50
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells CAL 27 (human tongue squamous cell carcinoma)
Animal Model
Administration Route
Output Type CIP2A mRNA knockdown
Output Value ~60% reduction vs siNT (48 h)
Output Units
Output Notes Protein knockdown shown; DY547-siRNA uptake quantified (~18-fold higher at 50:1 vs siRNA alone) and endocytic localization (EEA1 colocalization).
Toxicity Notes 50:1 showed no significant long-term cytotoxicity; 100:1 caused cytotoxicity
Curation Notes