Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)
Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH
| Experiment Id | EXP001305 |
|---|---|
| Paper | Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin |
| Peptide | RL2 (recombinant lactaptin) |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25 |
| Formulation Format | protein–nucleic acid noncovalent complex (polyplex) |
| Formulation Components | RL2:siRNA complexes formed in 25 mM MES pH 5.5 for 5 min at 37°C; N/P 10–35; cells co-transfected with pEGFP via Lipofectamine then treated with RL2:siRNA complexes |
| Size Nm | 110.00 |
| Zeta Mv | 10.30 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | A549 (human lung adenocarcinoma) |
| Animal Model | |
| Administration Route | |
| Output Type | gene knockdown |
| Output Value | EGFP fluorescence downregulated at N/P ≥25; flow cytometry shows ~50% decrease of EGFP at N/P=35 |
| Output Units | |
| Output Notes | Demonstrates functional cytosolic RNAi effect (EGFP silencing). |
| Toxicity Notes | |
| Curation Notes |