Back to browse

EXP001306

Paper

Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin (2019)

Peptide

RL2 (recombinant lactaptin)

Sequence: MNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPKKIQDKIIIPTIGGSHHHHHH

RNA

snoRNA (non-coding RNA)

All experiment fields

Experiment Id EXP001306
Paper Nucleic Acids Delivery Into the Cells Using Pro-Apoptotic Protein Lactaptin
Peptide RL2 (recombinant lactaptin)
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio N/P (charge) 5–9 for pDNA; 10–35 for siRNA; RL2 0.05–0.2 mg/mL for snoRNA U25
Formulation Format protein–nucleic acid noncovalent complex (polyplex)
Formulation Components RL2:U25 complexes in 25 mM MES pH 5.5; RL2 0.05–0.2 mg/mL; treated cells 48 h
Size Nm 110.00
Zeta Mv 10.30
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells A549 (human lung adenocarcinoma)
Animal Model
Administration Route
Output Type cell viability / functional effect
Output Value MTT assay shows decreased viability after RL2:U25 treatment; effect correlates with RL2 amount; free RL2 at same doses shows less effect
Output Units
Output Notes Used as functional readout confirming delivery of non-coding RNA cargo.
Toxicity Notes
Curation Notes