Investigation of LL-37-mediated siRNA transfection (2013)
LL-37 (TAMRA-labeled for imaging)
Sequence: [LL-37, 37 aa]
| Experiment Id | EXP001541 |
|---|---|
| Paper | Investigation of LL-37-mediated siRNA transfection |
| Peptide | LL-37 (TAMRA-labeled for imaging) |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | no |
| Endosomal Escape Evidence | |
| Peptide Concentration | 17.5 µg/mL TAMRA-LL-37 |
| Rna Concentration | 130 nM FITC-GFP siRNA |
| Mixing Ratio | charge ratio 4:1 (LL-37:siRNA) |
| Formulation Format | electrostatic peptide/siRNA complexes |
| Formulation Components | TAMRA-LL-37 + FITC-GFP siRNA |
| Size Nm | 68.00 |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | SKBR3 human breast adenocarcinoma cells (confocal microscopy) |
| Animal Model | |
| Administration Route | |
| Output Type | Uptake/localization (confocal microscopy) |
| Output Value | Efficient internalization; cytoplasmic/perinuclear puncta; siRNA not internalized when incubated alone |
| Output Units | |
| Output Notes | Confocal images after overnight incubation in serum-free media show FITC-siRNA internalized when complexed with TAMRA-LL-37, appearing punctate (suggestive of endosomal compartment). Chloroquine increased transfection efficiency (reported as unpublished observation). |
| Toxicity Notes | |
| Curation Notes |