Investigation of LL-37-mediated siRNA transfection (2013)
Sequence: RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (LL-37 residues 8–37)
| Experiment Id | EXP001543 |
|---|---|
| Paper | Investigation of LL-37-mediated siRNA transfection |
| Peptide | LL 8-37 |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | charge ratio 3:1 (LL 8-37:GFP siRNA) |
| Formulation Format | electrostatic peptide/siRNA complexes |
| Formulation Components | LL 8-37 fragment + GFP siRNA |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | HCC1143-GFP (breast cancer line stably expressing eGFP) |
| Animal Model | |
| Administration Route | |
| Output Type | Functional RNAi (GFP fluorescence reduction) |
| Output Value | Partial GFP knockdown observed (fluorescence microscopy) |
| Output Units | |
| Output Notes | LL 8-37 fragment, like full-length LL-37, induced GFP knockdown in HCC1143-GFP cells (reported qualitatively). |
| Toxicity Notes | |
| Curation Notes |