Back to browse

EXP001871

Paper

Engineered Proteinticles for Targeted Delivery of siRNA to Cancer Cells (2015)

Peptide

Proteinticle(ECP+CAP+ERP) (CPP-free)

Sequence: ECP:GRRGKGG | CAP:MARYRCCRSQSRSRYYRQRQRSRRRRRRSCQTRRRAMRCCRPRYRPRCRRH | CTP:VDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK

RNA

siRNA (poly-siRNA)

All experiment fields

Experiment Id EXP001871
Paper Engineered Proteinticles for Targeted Delivery of siRNA to Cancer Cells
Peptide Proteinticle(ECP+CAP+ERP) (CPP-free)
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence medium
In Vitro Functional Effect no
Endosomal Escape Evidence
Peptide Concentration Proteinticle carrier; complexes prepared at poly-siRNA:proteinticle 24:1. Assays typically used 100 nM siRNA-equivalent.
Rna Concentration 2 h incubation
Mixing Ratio Poly-siRNA:proteinticle molar ratio 24:1 (complex formation in PBS pH 7.4, 1 h RT)
Formulation Format Engineered ferritin proteinticle / poly-siRNA complex
Formulation Components Human ferritin heavy chain (hFTH) 24-mer proteinticle engineered to display peptide composite NH2–ECP–CAP–CPP–CTP–COOH (or variants lacking CPP/CTP). Poly-siRNA (disulfide-polymerized 5′-thiolated siRNA) electrostatically complexed to CAP on engineered proteinticles.
Size Nm 53.00
Zeta Mv
Model Scope in_vitro
Model Type in vitro
Cell Lines Or Primary Cells MDA-MB-468 human breast cancer (EGFR-expressing); uptake imaged with Cy5.5-labeled proteinticles and YOYO-1-labeled poly-siRNA
Animal Model
Administration Route
Output Type Cellular uptake/targeting (fluorescence microscopy)
Output Value Lower uptake vs CPP(+) counterpart
Output Units
Output Notes Shows CPP contribution to uptake.
Toxicity Notes Low cytotoxicity by CCK-8 and LDH in B16F10 up to ~1.2 µM complex (reported).
Curation Notes