Designing Cell Delivery Peptides and SARS-CoV-2-Targeting Small Interfering RNAs (2023)
Sequence: KWKSFLHVVKALTKVGKAVFSGVFDMIKCKISGGC
| Experiment Id | EXP002177 |
|---|---|
| Paper | Designing Cell Delivery Peptides and SARS-CoV-2-Targeting Small Interfering RNAs |
| Peptide | seq10 |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | no |
| Endosomal Escape Evidence | |
| Peptide Concentration | 20 µM (uptake assay) |
| Rna Concentration | |
| Mixing Ratio | |
| Formulation Format | peptide alone (uptake assay); no peptide–siRNA delivery tested |
| Formulation Components | seq10 |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | GFP-HeLa |
| Animal Model | |
| Administration Route | |
| Output Type | cellular uptake (fluorescence intensity) |
| Output Value | seq5 > TAT > seq7 (early time points) |
| Output Units | |
| Output Notes | Only peptide uptake was tested. No siRNA delivery, no gene knockdown, no reporter expression. seq5 showed ~2× fluorescence vs TAT at 1 h. |
| Toxicity Notes | No experimental cytotoxicity assays; ADME/Tox predictions reported in silico. |
| Curation Notes |