Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
| Experiment Id | EXP002554 |
|---|---|
| Paper | Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Na |
| Peptide | RVG9R |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | 25:1 peptide:siRNA molar ratio |
| Rna Concentration | 5–13.5 µg siRNA per dose (in vitro equivalent) |
| Mixing Ratio | 25:1 peptide:siRNA (molar) |
| Formulation Format | Peptide–siRNA electrostatic complex |
| Formulation Components | RVG9R peptide complexed with siRNA (25:1 molar ratio) |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | Primary neuronal cells; Vero cells (for virus assays) |
| Animal Model | |
| Administration Route | |
| Output Type | Gene knockdown (SOD1), uptake |
| Output Value | ~50% SOD1 knockdown across multiple brain regions |
| Output Units | |
| Output Notes | Fluorescence imaging + qPCR; receptor-mediated neuronal uptake |
| Toxicity Notes | |
| Curation Notes |