Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
| Experiment Id | EXP002555 |
|---|---|
| Paper | Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Na |
| Peptide | RVG9R |
| Delivery Success Class | yes |
| In Vivo Flag | yes |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | RVG9R-siRNA complexes |
| Rna Concentration | 9.1–13.5 µg siRNA per mouse per dose |
| Mixing Ratio | 25:1 peptide:siRNA |
| Formulation Format | Peptide–siRNA electrostatic complex |
| Formulation Components | RVG9R peptide complexed with siRNA (25:1 molar ratio) |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vivo |
| Model Type | in vivo |
| Cell Lines Or Primary Cells | |
| Animal Model | C3H mouse model of neuroinvasive West Nile virus infection |
| Administration Route | Intranasal (nose-to-brain) |
| Output Type | Survival, viral burden, neuropathology |
| Output Value | Up to 90% survival; >1,000-fold reduction in CNS viral load |
| Output Units | |
| Output Notes | Kaplan–Meier survival; reduced GFAP, TUNEL, viral antigen in brain |
| Toxicity Notes | No significant neuropathology or systemic toxicity |
| Curation Notes |