Back to browse

EXP002555

Paper

Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Natural Immunity to West Nile Virus (2018)

Peptide

RVG9R

Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

RNA

siRNA

All experiment fields

Experiment Id EXP002555
Paper Small Interfering RNA-Mediated Control of Virus Replication in the CNS Is Therapeutic and Enables Na
Peptide RVG9R
Delivery Success Class yes
In Vivo Flag yes
Uptake Confirmed yes
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence yes
Peptide Concentration RVG9R-siRNA complexes
Rna Concentration 9.1–13.5 µg siRNA per mouse per dose
Mixing Ratio 25:1 peptide:siRNA
Formulation Format Peptide–siRNA electrostatic complex
Formulation Components RVG9R peptide complexed with siRNA (25:1 molar ratio)
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo
Cell Lines Or Primary Cells
Animal Model C3H mouse model of neuroinvasive West Nile virus infection
Administration Route Intranasal (nose-to-brain)
Output Type Survival, viral burden, neuropathology
Output Value Up to 90% survival; >1,000-fold reduction in CNS viral load
Output Units
Output Notes Kaplan–Meier survival; reduced GFAP, TUNEL, viral antigen in brain
Toxicity Notes No significant neuropathology or systemic toxicity
Curation Notes