Sequence: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
| Experiment Id | EXP002569 |
|---|---|
| Paper | Crotamine/siRNA Nanocomplexes for Functional Downregulation of Syndecan-1 in Renal Proximal Tubular |
| Peptide | Crotamine |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | high |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | yes |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | 50:1 and 100:1 (crotamine:siRNA) |
| Formulation Format | CPP–siRNA electrostatic nanocomplex |
| Formulation Components | Crotamine + siRNA |
| Size Nm | 125.00 |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | HK-2 human proximal tubular epithelial cells |
| Animal Model | |
| Administration Route | |
| Output Type | Gene knockdown and complement activation |
| Output Value | Syndecan-1 mRNA/protein ↓ ~50%; reduced properdin binding and C3 activation |
| Output Units | |
| Output Notes | |
| Toxicity Notes | |
| Curation Notes |