Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC
| Experiment Id | EXP002472 |
|---|---|
| Paper | Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan |
| Peptide | eGLP-1-C / FOXO1 ASO 3b |
| Delivery Success Class | yes |
| In Vivo Flag | yes |
| Uptake Confirmed | no |
| Label Confidence | medium |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | covalent peptide-ASO conjugate |
| Formulation Format | GLP1R agonist peptide-ASO conjugate |
| Formulation Components | GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO targeting FOXO1 |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vivo |
| Model Type | in vivo |
| Cell Lines Or Primary Cells | |
| Animal Model | mouse pancreatic islets / beta-cell targeting context |
| Administration Route | systemic administration |
| Output Type | FOXO1 knockdown |
| Output Value | qualitative positive |
| Output Units | |
| Output Notes | In vivo FOXO1 ASO target knockdown is mentioned as part of the preliminary GLP1R-ASO conjugate evidence; no detailed quantitative FOXO1 figure is presented in the main paper. |
| Toxicity Notes | |
| Curation Notes |