Back to browse

EXP002472

Paper

Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pancreatic Beta Cell (2021)

Peptide

eGLP-1-C / FOXO1 ASO 3b

Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC

RNA

ASO

All experiment fields

Experiment Id EXP002472
Paper Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan
Peptide eGLP-1-C / FOXO1 ASO 3b
Delivery Success Class yes
In Vivo Flag yes
Uptake Confirmed no
Label Confidence medium
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio covalent peptide-ASO conjugate
Formulation Format GLP1R agonist peptide-ASO conjugate
Formulation Components GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO targeting FOXO1
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo
Cell Lines Or Primary Cells
Animal Model mouse pancreatic islets / beta-cell targeting context
Administration Route systemic administration
Output Type FOXO1 knockdown
Output Value qualitative positive
Output Units
Output Notes In vivo FOXO1 ASO target knockdown is mentioned as part of the preliminary GLP1R-ASO conjugate evidence; no detailed quantitative FOXO1 figure is presented in the main paper.
Toxicity Notes
Curation Notes