3TAT-DRBD (within STD fusion protein)
Sequence: GRKKRRQRRRGSHGRKKRRQRRRGSHGRKKRRQRRRGSHAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKA
| Experiment Id | EXP001478 |
|---|---|
| Paper | A specific aptamer-cell penetrating peptides complex delivered siRNA efficiently and suppressed pros |
| Peptide | 3TAT-DRBD (within STD fusion protein) |
| Delivery Success Class | yes |
| In Vivo Flag | yes |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | |
| Endosomal Escape Evidence | |
| Peptide Concentration | Systemic dosing described by siRNA amount: 400 pmol sur-siRNA per tail-vein injection, every other day ×7 (STD and A10 assembled as complex). |
| Rna Concentration | In vivo: 400 pmol sur-siRNA per injection (tail vein). |
| Mixing Ratio | Theoretical assembly: A10:STD:siRNA = 4:4:1 (4 DRBD per siRNA; 1 SA per biotin-A10). Assembly example: 10 µL 5 µM sur-siRNA + 10 µL 20–50 µM STD (PBS + 10% glycerol, on ice 30 min), then +10 µL 20 µM biotin-A10 (PBS pH 7.4, 30 min). |
| Formulation Format | A10-STD-(sur-siRNA) complex (aptamer-targeted CPP/DRBD fusion protein complex) |
| Formulation Components | STD fusion protein (streptavidin-3TAT-DRBD) + biotinylated PSMA aptamer A10 (2'-fluoro pyrimidine-modified) + SURVIVIN siRNA (FAM/Cy7-labeled for tracking in some assays). |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vivo |
| Model Type | in vivo |
| Cell Lines Or Primary Cells | |
| Animal Model | Male athymic BALB/c nude mice bearing LNCaP (PSMA+) subcutaneous xenografts (controls: PC-3 and HeLa xenografts for specificity imaging). |
| Administration Route | Intravenous (tail/caudal vein) systemic administration |
| Output Type | In vivo efficacy: tumor growth suppression (tumor volume over 21 days; tumor weight at day 21) after systemic dosing; in vivo targeting by Cy7 fluorescence imaging (IVIS) at 24 h post-injection. |
| Output Value | |
| Output Units | |
| Output Notes | After systemic administration, complex significantly suppressed LNCaP xenograft growth versus free siRNA and comparators; Cy7 imaging showed preferential accumulation in PSMA+ LNCaP xenografts (aptamer-dependent). |
| Toxicity Notes | Two accidental deaths reported in complex group during study (days ~13–15); no full PK/toxicity profiling included. |
| Curation Notes |