Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy (2017)
Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
| Experiment Id | EXP001777 |
|---|---|
| Paper | Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy |
| Peptide | RVG-9R |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | no |
| Label Confidence | high |
| In Vitro Functional Effect | no |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | 1.39 µg/well (final in apical compartment, Transwell permeability study) |
| Mixing Ratio | siRNA:peptide = 1:10 (molar); loaded into SLN; chitosan coating (NP:CS 1:1 w/w) |
| Formulation Format | Chitosan-coated solid lipid nanoparticles (SLN) encapsulating RVG-9R/siRNA complex |
| Formulation Components | RVG-9R/6-FAM–BACE1 siRNA complex (1:10 molar) encapsulated in SLN, surface-coated with chitosan |
| Size Nm | 358.44 |
| Zeta Mv | 10.54 |
| Model Scope | in_vitro |
| Model Type | in vitro |
| Cell Lines Or Primary Cells | Caco-2 (Transwell epithelial monolayer permeability model) |
| Animal Model | |
| Administration Route | |
| Output Type | Transepithelial transport (basolateral fluorescence RFU over time) |
| Output Value | Highest transport among tested formulations; most efficient at 60 min vs uncoated and non-formulated |
| Output Units | |
| Output Notes | Chitosan coating improved permeability (greater RFU) compared with uncoated SLN at key timepoints. |
| Toxicity Notes | Monolayer integrity monitored (Trypan Blue exclusion); no integrity loss reported. |
| Curation Notes |