Back to browse

EXP002469

Paper

Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pancreatic Beta Cell (2021)

Peptide

eGLP-1-C / FOXO1 ASO 3b

Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC

RNA

ASO

All experiment fields

Experiment Id EXP002469
Paper Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan
Peptide eGLP-1-C / FOXO1 ASO 3b
Delivery Success Class yes
In Vivo Flag yes
Uptake Confirmed no
Label Confidence high
In Vitro Functional Effect
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio covalent peptide-ASO conjugate
Formulation Format GLP1R agonist peptide-ASO conjugate
Formulation Components GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO via indicated linker
Size Nm
Zeta Mv
Model Scope in_vivo
Model Type in vivo
Cell Lines Or Primary Cells
Animal Model C57BL/6 mice; isolated pancreatic islets analyzed
Administration Route subcutaneous; once weekly for 2 weeks at 0.2, 0.07, or 0.02 μmol/kg
Output Type IAPP mRNA knockdown in pancreatic islets
Output Value Robust inhibition of IAPP mRNA; ED50 reported as 0.034 μmol/kg
Output Units
Output Notes Functional in vivo RNA knockdown in isolated pancreatic islets; positive delivery label.
Toxicity Notes
Curation Notes