Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC
| Experiment Id | EXP002471 |
|---|---|
| Paper | Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan |
| Peptide | eGLP-1-C / FOXO1 ASO 3b |
| Delivery Success Class | no |
| In Vivo Flag | no |
| Uptake Confirmed | yes |
| Label Confidence | medium |
| In Vitro Functional Effect | yes |
| Endosomal Escape Evidence | |
| Peptide Concentration | |
| Rna Concentration | |
| Mixing Ratio | covalent peptide-ASO conjugate |
| Formulation Format | GLP1R agonist peptide-ASO conjugate |
| Formulation Components | GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO targeting FOXO1 |
| Size Nm | |
| Zeta Mv | |
| Model Scope | in_vitro |
| Model Type | in vitro target knockdown/internalization |
| Cell Lines Or Primary Cells | GLP1R-expressing beta-cell model / in vitro target KD context |
| Animal Model | |
| Administration Route | |
| Output Type | FOXO1 knockdown/internalization evidence |
| Output Value | qualitative positive |
| Output Units | |
| Output Notes | Included because the paper identifies eGLP-1-C/FOXO1 ASO 3b and states GLP1R-mediated internalization with ASO-driven target knockdown in vitro and in vivo; details are referenced as preliminary/previously reported. |
| Toxicity Notes | |
| Curation Notes |