Back to browse

EXP002471

Paper

Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pancreatic Beta Cell (2021)

Peptide

eGLP-1-C / FOXO1 ASO 3b

Sequence: H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC

RNA

ASO

All experiment fields

Experiment Id EXP002471
Paper Glucagon Like Peptide 1 Receptor Agonists for Targeted Delivery of Antisense Oligonucleotides to Pan
Peptide eGLP-1-C / FOXO1 ASO 3b
Delivery Success Class no
In Vivo Flag no
Uptake Confirmed yes
Label Confidence medium
In Vitro Functional Effect yes
Endosomal Escape Evidence
Peptide Concentration
Rna Concentration
Mixing Ratio covalent peptide-ASO conjugate
Formulation Format GLP1R agonist peptide-ASO conjugate
Formulation Components GLP1R agonist peptide ligand covalently conjugated to cEt BNA/DNA gapmer ASO targeting FOXO1
Size Nm
Zeta Mv
Model Scope in_vitro
Model Type in vitro target knockdown/internalization
Cell Lines Or Primary Cells GLP1R-expressing beta-cell model / in vitro target KD context
Animal Model
Administration Route
Output Type FOXO1 knockdown/internalization evidence
Output Value qualitative positive
Output Units
Output Notes Included because the paper identifies eGLP-1-C/FOXO1 ASO 3b and states GLP1R-mediated internalization with ASO-driven target knockdown in vitro and in vivo; details are referenced as preliminary/previously reported.
Toxicity Notes
Curation Notes